PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010096513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 334aa    MW: 36580.6 Da    PI: 7.5014
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010096513.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.73.1e-3448102155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWt++LHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  XP_010096513.1  48 KQRLRWTHDLHERFVDAVQQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 102
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.49145105IPR017930Myb domain
SuperFamilySSF466891.24E-1747102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-3247103IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2648103IPR006447Myb domain, plants
PfamPF002493.5E-950101IPR001005SANT/Myb domain
PfamPF143791.8E-23134180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MYQPKGVPSS NFSRNNTFVH GQHLDSGANT MDPMNGGNSL NNPSLASKQR LRWTHDLHER  60
FVDAVQQLGG PDRATPKGVL RVMGVQGLTI YHVKSHLQKY RLAKYLPDSL SDGKKVDKKE  120
PGDALSNLDG SSGMQITEAL KLQMEVQKRL HEQLEVQRQL QLRIEAQGKY LKKIIEEQQR  180
LSGVLSETPG TELSAPAVGD NHPESDKTEP ATPAPTSEAP LQDKTAKERT AAKSLSVDES  240
LSSHHEPSTP DSSCHVGSPS ESPNGGRSAK KQRVNTGGAS GKPDLVLTHQ ILESSLNSSY  300
QQPHTVFLTR EQFESSGNTV RNDDQLEKVR SSDL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096513.10.0Myb family transcription factor APL
TrEMBLW9RQE90.0W9RQE9_9R
STRINGVIT_00s0475g00040.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF86103343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-109G2-like family protein